PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_25498A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 288aa    MW: 32395.7 Da    PI: 4.7252
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_25498AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.2e-154186147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               +g+W ++Ed  l + +  +G g+W++Ia+ ++ gRt+kqc +rw + 
  Oropetium_20150105_25498A 41 KGSWNAQEDATLREMISIHGEGNWAAIAEGLP-GRTRKQCYERWTNN 86
                               799*****************************.***********986 PP

2Myb_DNA-binding569.3e-1895137245
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                  WT+eEd  +v+a+k++G++ W++Iar++  gR+ +++k++w+
  Oropetium_20150105_25498A  95 SLWTEEEDRDFVEAHKLHGNR-WSAIARCLKSGRSQNSVKNHWN 137
                                56*******************.*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.3163691IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-203690IPR009057Homeodomain-like
SuperFamilySSF466896.12E-2638136IPR009057Homeodomain-like
SMARTSM007177.8E-174089IPR001005SANT/Myb domain
PfamPF002498.1E-154187IPR001005SANT/Myb domain
CDDcd001672.32E-144387No hitNo description
Gene3DG3DSA:1.10.10.608.5E-1691141IPR009057Homeodomain-like
PROSITE profilePS5129416.77592144IPR017930Myb domain
SMARTSM007172.0E-1493142IPR001005SANT/Myb domain
PfamPF002496.6E-1595137IPR001005SANT/Myb domain
CDDcd001671.07E-1097137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
METSIFNQHV ELVHEKSQQD AIRGWAGGGV NSQASAPQII KGSWNAQEDA TLREMISIHG  60
EGNWAAIAEG LPGRTRKQCY ERWTNNLRPE IKQRSLWTEE EDRDFVEAHK LHGNRWSAIA  120
RCLKSGRSQN SVKNHWNATM RSLGAKRWIK NKRSGQQVAF GQVTLLEEYI LSLQETFTES  180
ELLGEPGHEE FQAIPNTVNL TEGPAPRPDQ VMQGEVAHQN ASAPSDSCNP QEIGSYTDPT  240
SLNVMQGTQE YDDNAFNDLD VNYDLPFFMD DVNFAFELDG KDTWKNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-31371413105B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.12e-44PREDICTED: transcription factor RAX1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.12e-35myb domain protein 64